DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and KCNQ5

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001153605.1 Gene:KCNQ5 / 56479 HGNCID:6299 Length:951 Species:Homo sapiens


Alignment Length:97 Identity:21/97 - (21%)
Similarity:32/97 - (32%) Gaps:15/97 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FGKRHNKTHTLCRRCGRSSYHIQKS--------------TCAQCGYPAAKLRSYNWSVKAKRRKT 58
            |.||.|....|.:...||....:||              ||:.......:..|..:....::...
Human   363 FEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSKFCSNKQKLFR 427

  Fly    59 TGTGRMQHLKV-VRRRFRNGFREGTQAKPKKA 89
            ..|.|.|..|: .:.|.|.....|...|.::|
Human   428 MYTSRKQSQKLSFKERVRMASPRGQSIKSRQA 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 21/97 (22%)
KCNQ5NP_001153605.1 Ion_trans 126..358 CDD:459842
Interaction with CALM. /evidence=ECO:0000269|PubMed:29429937 370..378 1/7 (14%)
KCNQ_channel 466..653 CDD:460954
Interaction with CALM. /evidence=ECO:0000269|PubMed:29429937 540..547
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 674..697
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 895..938
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.