DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and si:rp71-39b20.4

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_005171298.1 Gene:si:rp71-39b20.4 / 563472 ZFINID:ZDB-GENE-070912-704 Length:539 Species:Danio rerio


Alignment Length:51 Identity:15/51 - (29%)
Similarity:23/51 - (45%) Gaps:5/51 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GYPAA----KLRSYNWSVKAKRRKTTGTGRMQHLKV-VRRRFRNGFREGTQ 83
            |.|.:    |...|...:||:....|...|..:||. :|::|.|.|...|:
Zfish   474 GMPISILFNKFSDYYAKLKAQECTNTNIQRGLNLKKRLRKKFDNCFEPQTE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 15/51 (29%)
si:rp71-39b20.4XP_005171298.1 BTB_POZ 90..197 CDD:453885
Ion_trans 249..492 CDD:459842 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.