DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and kcns3b

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001032460.1 Gene:kcns3b / 558674 ZFINID:ZDB-GENE-051120-78 Length:424 Species:Danio rerio


Alignment Length:39 Identity:11/39 - (28%)
Similarity:16/39 - (41%) Gaps:5/39 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SFGKRHNKTHTLCRRCGRSSY-HIQKSTCAQCGYPAAKL 44
            :.|..|:|.    .||....: |.:.:...||...||.|
Zfish    20 NIGGIHHKV----ERCVLLRFPHTRVAQLIQCHSDAAIL 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 11/39 (28%)
kcns3bNP_001032460.1 BTB_POZ 15..117 CDD:453885 11/39 (28%)
Ion_trans 186..414 CDD:459842
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.