| Sequence 1: | NP_573005.1 | Gene: | RpL37-1 / 32446 | FlyBaseID: | FBgn0030616 | Length: | 93 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001032460.1 | Gene: | kcns3b / 558674 | ZFINID: | ZDB-GENE-051120-78 | Length: | 424 | Species: | Danio rerio |
| Alignment Length: | 39 | Identity: | 11/39 - (28%) |
|---|---|---|---|
| Similarity: | 16/39 - (41%) | Gaps: | 5/39 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 SFGKRHNKTHTLCRRCGRSSY-HIQKSTCAQCGYPAAKL 44 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-1 | NP_573005.1 | PTZ00073 | 1..91 | CDD:240257 | 11/39 (28%) |
| kcns3b | NP_001032460.1 | BTB_POZ | 15..117 | CDD:453885 | 11/39 (28%) |
| Ion_trans | 186..414 | CDD:459842 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||