DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and RGD1561310

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_038952186.1 Gene:RGD1561310 / 498744 RGDID:1561310 Length:97 Species:Rattus norvegicus


Alignment Length:92 Identity:65/92 - (70%)
Similarity:74/92 - (80%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65
            ||||.|||||..|.|||||||||..::|:|||||.:|||||...|.||||.|||||.|||||||:
  Rat     1 MTKGRSSFGKHRNMTHTLCRRCGSKAHHLQKSTCGKCGYPAKPKRKYNWSAKAKRRNTTGTGRMR 65

  Fly    66 HLKVVRRRFRNGFREGTQAKPKKAVAS 92
            |||:|.||||:||||||..|||:|..:
  Rat    66 HLKIVYRRFRHGFREGTTPKPKRAAVA 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 65/89 (73%)
RGD1561310XP_038952186.1 PTZ00073 1..88 CDD:240257 63/86 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10768
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.