| Sequence 1: | NP_573005.1 | Gene: | RpL37-1 / 32446 | FlyBaseID: | FBgn0030616 | Length: | 93 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097646.1 | Gene: | Shal / 40129 | FlyBaseID: | FBgn0005564 | Length: | 571 | Species: | Drosophila melanogaster |
| Alignment Length: | 49 | Identity: | 10/49 - (20%) |
|---|---|---|---|
| Similarity: | 21/49 - (42%) | Gaps: | 5/49 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 RSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASK 93 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-1 | NP_573005.1 | PTZ00073 | 1..91 | CDD:240257 | 10/45 (22%) |
| Shal | NP_001097646.1 | BTB_POZ_Shal-like | 6..144 | CDD:349727 | |
| Ion_trans | 188..415 | CDD:459842 | 2/3 (67%) | ||
| DUF3399 | 471..535 | CDD:463381 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||