| Sequence 1: | NP_573005.1 | Gene: | RpL37-1 / 32446 | FlyBaseID: | FBgn0030616 | Length: | 93 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_000209.2 | Gene: | KCNQ1 / 3784 | HGNCID: | 6294 | Length: | 676 | Species: | Homo sapiens |
| Alignment Length: | 53 | Identity: | 14/53 - (26%) |
|---|---|---|---|
| Similarity: | 21/53 - (39%) | Gaps: | 4/53 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 AAKLRSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASK 93 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RpL37-1 | NP_573005.1 | PTZ00073 | 1..91 | CDD:240257 | 12/49 (24%) |
| KCNQ1 | NP_000209.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 62..84 | ||||
| Ion_trans | 123..359 | CDD:459842 | |||
| Interaction with KCNE3. /evidence=ECO:0000269|PubMed:31883792 | 238..246 | ||||
| Interaction with CALM. /evidence=ECO:0000269|PubMed:25441029 | 370..382 | 4/10 (40%) | |||
| KCNQ_channel | <511..617 | CDD:460954 | |||
| Interaction with CALM, calcium-dependent. /evidence=ECO:0000269|PubMed:25441029 | 515..529 | ||||
| Interaction with KCNE1 C-terminus. /evidence=ECO:0000269|PubMed:25037568 | 535..572 | ||||
| Interaction with AKAP9. /evidence=ECO:0000269|PubMed:11799244 | 588..616 | ||||
| C-terminal assembly domain (tetramerization). /evidence=ECO:0000269|PubMed:10654932 | 589..620 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 620..676 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||