DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and KCNQ1

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_000209.2 Gene:KCNQ1 / 3784 HGNCID:6294 Length:676 Species:Homo sapiens


Alignment Length:53 Identity:14/53 - (26%)
Similarity:21/53 - (39%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AAKLRSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASK 93
            ||.|....|...|.....:.|.::    .:|:..|:........||||:|..|
Human   371 AASLIQTAWRCYAAENPDSSTWKI----YIRKAPRSHTLLSPSPKPKKSVVVK 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 12/49 (24%)
KCNQ1NP_000209.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..84
Ion_trans 123..359 CDD:459842
Interaction with KCNE3. /evidence=ECO:0000269|PubMed:31883792 238..246
Interaction with CALM. /evidence=ECO:0000269|PubMed:25441029 370..382 4/10 (40%)
KCNQ_channel <511..617 CDD:460954
Interaction with CALM, calcium-dependent. /evidence=ECO:0000269|PubMed:25441029 515..529
Interaction with KCNE1 C-terminus. /evidence=ECO:0000269|PubMed:25037568 535..572
Interaction with AKAP9. /evidence=ECO:0000269|PubMed:11799244 588..616
C-terminal assembly domain (tetramerization). /evidence=ECO:0000269|PubMed:10654932 589..620
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 620..676
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.