DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and RpL37b

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_611757.1 Gene:RpL37b / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster


Alignment Length:87 Identity:67/87 - (77%)
Similarity:75/87 - (86%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65
            |||||:|||||||||||:|||||.||||:|||.|:||||||||.||:|||.|||.||..|||||:
  Fly     1 MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMR 65

  Fly    66 HLKVVRRRFRNGFREGTQAKPK 87
            :||.:|||||||.|||..||.|
  Fly    66 YLKNLRRRFRNGLREGGAAKKK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 67/87 (77%)
RpL37bNP_611757.1 PTZ00073 1..89 CDD:240257 67/87 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449350
Domainoid 1 1.000 91 1.000 Domainoid score I2619
eggNOG 1 0.900 - - E1_COG2126
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I1761
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130191at33392
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - mtm1080
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - P PTHR10768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X874
1110.800

Return to query results.
Submit another query.