DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and KCNC4

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_024302558.1 Gene:KCNC4 / 3749 HGNCID:6236 Length:661 Species:Homo sapiens


Alignment Length:74 Identity:20/74 - (27%)
Similarity:24/74 - (32%) Gaps:17/74 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 STCAQCGYPAAKL---------RSYNWSVKAKRRKTTGTGRMQHL-----KVVRRRFRNGFREGT 82
            |||:....||.:.         ...|....|......|.|..|.|     ...||..|   |..|
Human   518 STCSDTSPPAREEGMIERKRADSKQNGDANAVLSDEEGAGLTQPLASSPTPEERRALR---RSTT 579

  Fly    83 QAKPKKAVA 91
            :.:.|||.|
Human   580 RDRNKKAAA 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 19/72 (26%)
KCNC4XP_024302558.1 Potassium_chann 1..29 CDD:431870
BTB_KCNC2_4 35..158 CDD:349722
Ion_trans 225..483 CDD:459842
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.