DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and KCNC4

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_024302558.1 Gene:KCNC4 / 3749 HGNCID:6236 Length:661 Species:Homo sapiens


Alignment Length:74 Identity:20/74 - (27%)
Similarity:24/74 - (32%) Gaps:17/74 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 STCAQCGYPAAKL---------RSYNWSVKAKRRKTTGTGRMQHL-----KVVRRRFRNGFREGT 82
            |||:....||.:.         ...|....|......|.|..|.|     ...||..|   |..|
Human   518 STCSDTSPPAREEGMIERKRADSKQNGDANAVLSDEEGAGLTQPLASSPTPEERRALR---RSTT 579

  Fly    83 QAKPKKAVA 91
            :.:.|||.|
Human   580 RDRNKKAAA 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 19/72 (26%)
KCNC4XP_024302558.1 Potassium_chann 1..29 CDD:314363
BTB_2 38..143 CDD:308049
Ion_trans 225..483 CDD:306908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.