DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and KCNB1

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_004966.1 Gene:KCNB1 / 3745 HGNCID:6231 Length:858 Species:Homo sapiens


Alignment Length:57 Identity:11/57 - (19%)
Similarity:19/57 - (33%) Gaps:13/57 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RSYNWSVKAKRRKTTGTGRMQHLKVVR-------------RRFRNGFREGTQAKPKK 88
            :|:....:....|...:...|||.|.:             :...|......|:|||:
Human   502 KSFETKEQGSPEKARSSSSPQHLNVQQLEDMYNKMAKTQSQPILNTKESAAQSKPKE 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 11/57 (19%)
KCNB1NP_004966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
BTB_POZ_KCNB2 15..141 CDD:349719
Self-association. /evidence=ECO:0000250|UniProtKB:P15387 59..75
Ion_trans 188..424 CDD:395416
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 377..382
Self-association. /evidence=ECO:0000250|UniProtKB:P15387 448..481
Kv2channel 467..679 CDD:397541 11/57 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 471..524 3/21 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 538..574 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 770..807
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 836..858
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.