DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and KCNB1

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_004966.1 Gene:KCNB1 / 3745 HGNCID:6231 Length:858 Species:Homo sapiens


Alignment Length:57 Identity:11/57 - (19%)
Similarity:19/57 - (33%) Gaps:13/57 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RSYNWSVKAKRRKTTGTGRMQHLKVVR-------------RRFRNGFREGTQAKPKK 88
            :|:....:....|...:...|||.|.:             :...|......|:|||:
Human   502 KSFETKEQGSPEKARSSSSPQHLNVQQLEDMYNKMAKTQSQPILNTKESAAQSKPKE 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 11/57 (19%)
KCNB1NP_004966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
BTB_POZ_KCNB2 15..141 CDD:349719
Self-association. /evidence=ECO:0000250|UniProtKB:P15387 59..75
Ion_trans 188..424 CDD:459842
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 377..382
Self-association. /evidence=ECO:0000250|UniProtKB:P15387 448..481
Kv2channel 467..679 CDD:397541 11/57 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 471..524 3/21 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 538..574 5/21 (24%)
FFAT. /evidence=ECO:0000269|PubMed:33124732 590..596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 770..807
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 836..858
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.