DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpL37a and KCNA6

DIOPT Version :9

Sequence 1:	NP_001259561.1	Gene:	RpL37a / 32446	FlyBaseID:	FBgn0030616	Length:	93	Species:	Drosophila melanogaster
Sequence 2:	NP_002226.1	Gene:	KCNA6 / 3742	HGNCID:	6225	Length:	529	Species:	Homo sapiens

Alignment Length:	61	Identity:	16/61 - (26%)
Similarity:	21/61 - (34%)	Gaps:	15/61 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    33 TCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASK 93
            |...||.||..||:.:          .|.|:....:..|.|     |......|.:|.|.|
Human   478 THVTCGQPAPDLRATD----------NGLGKPDFPEANRER-----RPSYLPTPHRAYAEK 523

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpL37a	NP_001259561.1	PTZ00073	1..91	CDD:240257	14/57 (25%)
KCNA6	NP_002226.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..33
		BTB_POZ_KCNA6	41..170	CDD:349714
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	210..233
		Ion_trans	258..468	CDD:366146
		S4-S5 linker. /evidence=ECO:0000250\|UniProtKB:P63142	360..373
		Selectivity filter. /evidence=ECO:0000250\|UniProtKB:P63142	422..427
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	488..513		7/39 (18%)
		PDZ-binding. /evidence=ECO:0000255	527..529
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2126
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900