DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and KCNA3

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_002223.3 Gene:KCNA3 / 3738 HGNCID:6221 Length:575 Species:Homo sapiens


Alignment Length:104 Identity:23/104 - (22%)
Similarity:31/104 - (29%) Gaps:26/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKL------RSYNWSVKAKRRKTT 59
            :|..|..:|..|..|         ....|..|.||..|.....|      .::|:..   .|:|.
Human   440 VTMTTVGYGDMHPVT---------IGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY---HRETE 492

  Fly    60 G--------TGRMQHLKVVRRRFRNGFREGTQAKPKKAV 90
            |        .|..|||.......|......|.:|.:..|
Human   493 GEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMV 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 23/104 (22%)
KCNA3NP_002223.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
BTB_POZ 104..230 CDD:453885
Ion_trans 233..490 CDD:459842 12/61 (20%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 444..449 1/4 (25%)
Interaction with KCNE4. /evidence=ECO:0000250|UniProtKB:P15384 482..575 12/53 (23%)
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P15384 573..575
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.