DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and KCNQ

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_788300.3 Gene:KCNQ / 36071 FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster


Alignment Length:95 Identity:25/95 - (26%)
Similarity:35/95 - (36%) Gaps:25/95 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GKRHNKT-------HTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVK--AKRRKTTGTGRM 64
            ||..|.:       .|.|.:..::|...|.:|.|.|     ||.|...|:.  ..|.:.....|.
  Fly   424 GKSMNPSFSEDSVAETTCLKNIKNSDASQPATLANC-----KLSSSAGSLAQFPDRNRDRDQDRR 483

  Fly    65 QHLKVVRRRFRNGFREGTQAKPK-KAVASK 93
            .|          |..||.||:.: ||..|:
  Fly   484 GH----------GEGEGDQAEEQAKAGGSR 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 24/91 (26%)
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921
Ion_trans_2 221..295 CDD:285168
KCNQ_channel <619..719 CDD:281513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.