DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and RGD1560186

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_038947436.1 Gene:RGD1560186 / 289384 RGDID:1560186 Length:93 Species:Rattus norvegicus


Alignment Length:92 Identity:61/92 - (66%)
Similarity:70/92 - (76%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65
            |||||||||||.||||||||.||..::|:||.||.:|||||...|..|||.|||||.|.|||||:
  Rat     1 MTKGTSSFGKRRNKTHTLCRCCGSKAHHLQKLTCGKCGYPAKCKRKCNWSAKAKRRNTPGTGRMR 65

  Fly    66 HLKVVRRRFRNGFREGTQAKPKKAVAS 92
            |||:|    |:||||||..|||:|..:
  Rat    66 HLKIV----RHGFREGTTPKPKRAAVA 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 61/89 (69%)
RGD1560186XP_038947436.1 Ribosomal_L37e 1..84 CDD:412655 59/86 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I6986
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4182
OMA 1 1.010 - - QHG53564
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - otm44752
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - O PTHR10768
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X874
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.