DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and rpl3702

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_588350.1 Gene:rpl3702 / 2538715 PomBaseID:SPCC1223.05c Length:91 Species:Schizosaccharomyces pombe


Alignment Length:92 Identity:67/92 - (72%)
Similarity:75/92 - (81%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65
            |||||.|||.||||:||:|||||:.|:||||||||.|||||||.|||||..|||||:|||||||.
pombe     1 MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMS 65

  Fly    66 HLKVVRRRFRNGFREGTQAKPKKAVAS 92
            :||.|.|.|:||||.|   ||..|||:
pombe    66 YLKKVHRSFKNGFRSG---KPAAAVAA 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 65/89 (73%)
rpl3702NP_588350.1 PTZ00073 1..81 CDD:240257 61/79 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I1813
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68110
Inparanoid 1 1.050 145 1.000 Inparanoid score I1334
OMA 1 1.010 - - QHG53564
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - mtm9284
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - LDO PTHR10768
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1133
SonicParanoid 1 1.000 - - X874
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.