DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and rpl-37

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_497727.1 Gene:rpl-37 / 175460 WormBaseID:WBGene00004451 Length:91 Species:Caenorhabditis elegans


Alignment Length:87 Identity:57/87 - (65%)
Similarity:69/87 - (79%) Gaps:1/87 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65
            |||||.:|||:|.|:||||:|||:||:||||..||.|||..||.|:|||..|:.||:||||||.:
 Worm     1 MTKGTQAFGKKHVKSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSIRRRTTGTGRTR 65

  Fly    66 HLKVVRRRFRNGFREGTQAKPK 87
            ||:.|..||||||| ||..||:
 Worm    66 HLRDVNARFRNGFR-GTTPKPR 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 57/87 (66%)
rpl-37NP_497727.1 PTZ00073 1..90 CDD:240257 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159454
Domainoid 1 1.000 88 1.000 Domainoid score I5040
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68110
Inparanoid 1 1.050 137 1.000 Inparanoid score I3119
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53564
OrthoDB 1 1.010 - - D1560654at2759
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - mtm4813
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - O PTHR10768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X874
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.