DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and KCNV2

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_598004.1 Gene:KCNV2 / 169522 HGNCID:19698 Length:545 Species:Homo sapiens


Alignment Length:53 Identity:15/53 - (28%)
Similarity:19/53 - (35%) Gaps:12/53 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQHLKV 69
            ||....|..||  |...|...|:|..:|          .|..|.|.|.:.|.:
Human    98 TLNVNVGGHSY--QLDYCELAGFPKTRL----------GRLATSTSRSRQLSL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 15/53 (28%)
KCNV2NP_598004.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..93
BTB_POZ 99..206 CDD:453885 14/52 (27%)
Ion_trans 266..504 CDD:459842
Selectivity filter. /evidence=ECO:0000250 457..462
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.