DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and Kcnq2

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_017171224.1 Gene:Kcnq2 / 16536 MGIID:1309503 Length:937 Species:Mus musculus


Alignment Length:110 Identity:24/110 - (21%)
Similarity:36/110 - (32%) Gaps:43/110 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKL-RSYNWSVKAKRRKTTGTGRM 64
            :.:.|||.|                    |::..|....|.|:. .|.:|....:|..|:..|  
Mouse   757 IVRSTSSTG--------------------QRNYAAPPAIPPAQCPPSTSWQQSHQRHGTSPVG-- 799

  Fly    65 QHLKVVR-----------RRFRNGFR--------EGTQA-KPKKA 89
            .|..:||           ..:..|.|        |||.| :|.:|
Mouse   800 DHGSLVRIPPPPAHERSLSAYGGGNRASTEFLRLEGTPACRPSEA 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 24/110 (22%)
Kcnq2XP_017171224.1 Ion_trans 92..324 CDD:366146
KCNQ_channel 466..719 CDD:367540
KCNQ2_u3 734..821 CDD:374697 16/85 (19%)
KCNQC3-Ank-G_bd 840..933 CDD:371819 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.