DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and Kcnb1

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_032446.2 Gene:Kcnb1 / 16500 MGIID:96666 Length:857 Species:Mus musculus


Alignment Length:42 Identity:9/42 - (21%)
Similarity:17/42 - (40%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKP 86
            :|:....:....|...:...|||.|.:.:........||::|
Mouse   502 KSFETKEQGSPEKARSSSSPQHLNVQQLQDMYSKMAKTQSQP 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 9/42 (21%)
Kcnb1NP_032446.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
BTB_POZ_KCNB2 15..141 CDD:349719
Self-association. /evidence=ECO:0000250|UniProtKB:P15387 59..75
Ion_trans 188..424 CDD:459842
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 377..382
Self-association. /evidence=ECO:0000250|UniProtKB:P15387 448..481
Kv2channel 467..678 CDD:397541 9/42 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..569 9/42 (21%)
FFAT. /evidence=ECO:0000250|UniProtKB:Q14721 590..596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 608..627
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..802
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 816..857
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.