DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and Kcna5

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_666095.1 Gene:Kcna5 / 16493 MGIID:96662 Length:602 Species:Mus musculus


Alignment Length:37 Identity:10/37 - (27%)
Similarity:16/37 - (43%) Gaps:1/37 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GRSSYHIQKSTCAQCGY-PAAKLRSYNWSVKAKRRKT 58
            |.:.....:|...:||. |.|.|.:.:.....:||.|
Mouse    20 GEAGASCVQSPRGECGCPPTAGLNNQSKETSPRRRAT 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 10/37 (27%)
Kcna5NP_666095.1 Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P22460 1..202 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107 10/37 (27%)
BTB_POZ 111..237 CDD:453885
Ion_trans 240..515 CDD:459842
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..297
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 407..420
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 469..474
PDZ-binding 600..602
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.