DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and Kcna3

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_032444.2 Gene:Kcna3 / 16491 MGIID:96660 Length:528 Species:Mus musculus


Alignment Length:104 Identity:23/104 - (22%)
Similarity:31/104 - (29%) Gaps:26/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKL------RSYNWSVKAKRRKTT 59
            :|..|..:|..|..|         ....|..|.||..|.....|      .::|:..   .|:|.
Mouse   393 VTMTTVGYGDMHPVT---------IGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY---HRETE 445

  Fly    60 G--------TGRMQHLKVVRRRFRNGFREGTQAKPKKAV 90
            |        .|..|||.......|......|.:|.:..|
Mouse   446 GEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMV 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 23/104 (22%)
Kcna3NP_032444.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
BTB 59..153 CDD:197585
BTB_2 59..150 CDD:280393
Ion_trans 243..443 CDD:278921 12/61 (20%)
Ion_trans_2 357..434 CDD:285168 11/49 (22%)
Selectivity filter. /evidence=ECO:0000250 397..402 1/4 (25%)
PDZ-binding. /evidence=ECO:0000250 526..528
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.