DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37-1 and Kcnd1

DIOPT Version :10

Sequence 1:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001099218.1 Gene:Kcnd1 / 116695 RGDID:621364 Length:650 Species:Rattus norvegicus


Alignment Length:39 Identity:8/39 - (20%)
Similarity:19/39 - (48%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQ 83
            |.|:.:.:|.:|:.....|:..:::.:....|.|.:..|
  Rat   413 RIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQ 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 8/39 (21%)
Kcnd1NP_001099218.1 BTB_POZ 6..143 CDD:453885
Ion_trans 185..417 CDD:459842 2/3 (67%)
DUF3399 470..550 CDD:463381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.