DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37a and rpl37

DIOPT Version :9

Sequence 1:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001107325.1 Gene:rpl37 / 100135133 XenbaseID:XB-GENE-956873 Length:97 Species:Xenopus tropicalis


Alignment Length:92 Identity:70/92 - (76%)
Similarity:78/92 - (84%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65
            |||||||||||.|||||||||||..:||:|||||.:|||||.:.|.||||.|||||.|||||||:
 Frog     1 MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMR 65

  Fly    66 HLKVVRRRFRNGFREGTQAKPKKAVAS 92
            |||||.|||:|||||||..|||:|..:
 Frog    66 HLKVVYRRFKNGFREGTTPKPKRAAVA 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 70/89 (79%)
rpl37NP_001107325.1 PTZ00073 1..88 CDD:240257 68/86 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7050
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68110
Inparanoid 1 1.050 134 1.000 Inparanoid score I4462
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1560654at2759
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - otm47790
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X874
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.