DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP735A2

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_176882.1 Gene:CYP735A2 / 843031 AraportID:AT1G67110 Length:512 Species:Arabidopsis thaliana


Alignment Length:468 Identity:141/468 - (30%)
Similarity:217/468 - (46%) Gaps:75/468 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LNWLKELREKHGPVFRIWFGKDLMVMFTDPEDIKQLL-GNNQLLTKSRNYELLEPWL-------- 108
            ::|.|:    :|..|.:|.|.:..:..|:.|.||:|| .:|.:..||        ||        
plant    88 VSWSKQ----YGKRFIMWNGTEPRLCLTETEMIKELLTKHNPVTGKS--------WLQQQGTKGF 140

  Fly   109 -GKGLLTNGGESWHRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLF 172
             |:|||...||:||.:|.:..|.|....|..:.:.|.|..:::..||| |..||..:|...:...
plant   141 IGRGLLMANGEAWHHQRHMAAPAFTRDRLKGYAKHMVECTKMMAERLR-KEVGEEVEIGEEMRRL 204

  Fly   173 ALDAICETAMG--IKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTK--PGK-ERE 232
            ..|.|..|..|  ..|..:|.|   .:..:|.:|....:         ::.|..::  |.| .||
plant   205 TADIISRTEFGSSCDKGKELFS---LLTVLQRLCAQATR---------HLCFPGSRFLPSKYNRE 257

  Fly   233 AALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLD---MLLLTQMEGGA-ELS 293
              :|.|..|..|::.    ::|..|        :|.|...|..::.|   .|||.||:... .|:
plant   258 --IKSLKTEVERLLM----EIIDSR--------KDSVEIGRSSSYGDDLLGLLLNQMDSNKNNLN 308

  Fly   294 DTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGR-------EKESMPYL 351
            ...|.:|..||.|.||:|||..:.:.|.||:.||..|....:|..::.|:       :..|:..|
plant   309 VQMIMDECKTFFFTGHETTSLLLTWTLMLLAHNPTWQDNVRDEVRQVCGQDGVPSVEQLSSLTSL 373

  Fly   352 EAVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNF-PDPERFDPDRFL 415
            ..||.|:||:||......|...||:::|.|.:|||.||...:..:|...:.: .|...|:|:||.
plant   374 NKVINESLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSNELWGEDANEFNPERFT 438

  Fly   416 VNEKQMHPFA----FAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTK 476
            ...     ||    |..|:|||||||||.|||:|.|..||||:..:.|...::::..|:..|..|
plant   439 TRS-----FASSRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSFAISENYRHAPIVVLTIK 498

  Fly   477 SGNGIRLRILPRD 489
            ...|::|.:.|.|
plant   499 PKYGVQLVLKPLD 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 134/446 (30%)
CYP735A2NP_176882.1 PLN02290 2..511 CDD:215164 140/466 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.