DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP702A1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:492 Identity:113/492 - (22%)
Similarity:183/492 - (37%) Gaps:158/492 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KTLPG----PTIGELIANVKKGEIL---NWLKELREKHGPVFRI-WFGKDLMVMFTDPE------ 83
            |..||    |.|||....:|..:..   .::||...::||:||. .||..:::. ||.|      
plant    34 KLPPGSMGFPIIGETFEFMKPHDAFQFPTFIKERIIRYGPIFRTSLFGAKVIIS-TDIELNMEIA 97

  Fly    84 ----------DIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGGESWHRRRKLLT------PGFH 132
                      .|.||.|.|.|..:|:                  || |:..:.||      .|..
plant    98 KTNHAPGLTKSIAQLFGENNLFFQSK------------------ES-HKHVRNLTFQLLGSQGLK 143

  Fly   133 FRILSEF----KEPMEENCR------------ILVRRLRTKANGESFDIYPYITLFALDAICETA 181
            ..::.:.    :..|||..|            ||:..|..|..|   |:.|       :|..|.|
plant   144 LSVMQDIDLLTRTHMEEGARRGCLDVKEISSKILIECLAKKVTG---DMEP-------EAAKELA 198

  Fly   182 MGIKKHAQLQSDSEYVQAVQSICRVMHKQSF-SFWQRLNVFFKHTKPGKEREAALKVLHDETNRV 245
                                 :|    .:.| |.|.|..:....|...|..:|..::||      
plant   199 ---------------------LC----WRCFPSGWFRFPLNLPGTGVYKMMKARKRMLH------ 232

  Fly   246 IRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHD 310
              |.:|.::::|      |..:::|...::.|         ||...:|..:..|.:.|.....::
plant   233 --LLKETILKKR------ASGEELGEFFKIIF---------EGAETMSVDNAIEYIYTLFLLANE 280

  Fly   311 TTSSAIAFALSLLSKNPDVQQRAF-----------EEASELEGREKESMPYLEAVIKETLRIYPS 364
            ||...:|..:.|:|.||.|.:...           |:.:.:...|.:||.:.:.||.|:|||..:
plant   281 TTPRILAATIKLISDNPKVMKELHREHEGIVRGKTEKETSITWEEYKSMTFTQMVINESLRITST 345

  Fly   365 VPFFSRKVLEDLEVGKLTVPKGASISCLIYM----LHRDPKNFPDPERFDPDRF-------LVNE 418
            .|...|....:.:||...:|.|     .|:|    .|.:||.:.||..|:|.|:       :|:.
plant   346 APTVFRIFDHEFQVGSYKIPAG-----WIFMGYPNNHFNPKTYDDPLVFNPWRWEGKDLGAIVSR 405

  Fly   419 KQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLR 455
                  .:..|.||.|.|:|.:||.|::...:..|.|
plant   406 ------TYIPFGAGSRQCVGAEFAKLQMAIFIHHLSR 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 112/490 (23%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 113/492 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.