DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP96A15

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_176086.1 Gene:CYP96A15 / 842150 AraportID:AT1G57750 Length:497 Species:Arabidopsis thaliana


Alignment Length:533 Identity:116/533 - (21%)
Similarity:222/533 - (41%) Gaps:91/533 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALVAFVLWAAFLRYLPKILNFLRLQR------------FAKTLPGPTIGELIANVKKGEILNWL 56
            :|::.|  :..|:.:|..:..:..||:            |.:.|||     ::..:.:  |.:|.
plant     1 MAMLGF--YVTFIFFLVCLFTYFFLQKKPQGQPILKNWPFLRMLPG-----MLHQIPR--IYDWT 56

  Fly    57 KELREKHGPVFRI---WFGKDLMVMFTDPEDIKQLLGNN-QLLTKSRNYELLEPWLGKGLLTNGG 117
            .|:.|.....|..   |.....|:...||.:|..:|.:| ....|...::.:...||:|:||...
plant    57 VEVLEATNLTFYFKGPWLSGTDMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDF 121

  Fly   118 ESWHRRRKLLTPGFHFR-----ILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAI 177
            |.|...||.....||.:     .:|..|..::|.                  :.|::...|...|
plant   122 ELWEEMRKSNHALFHNQDFIELSVSSNKSKLKEG------------------LVPFLDNAAQKNI 168

  Fly   178 CETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLN-----VFFKHTKP---------- 227
            ......:.:.....:.|..:.....:...:......|.:..:     ::::|.||          
plant   169 IIELQDVFQRFMFDTSSILMTGYDPMSLSIEMLEVEFGEAADIGEEAIYYRHFKPVILWRLQNWI 233

  Fly   228 --GKERE--AALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEG 288
              |.||:  .||..::....::|..||::.| .|.:.:|.       :|..|.:...:..::.:.
plant   234 GIGLERKMRTALATVNRMFAKIISSRRKEEI-SRAKTEPY-------SKDALTYYMNVDTSKYKL 290

  Fly   289 GAELSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEA-SELEGREKESMPYLE 352
            .....|..||:.:.:.:..|.|||||.:.:...||||:|.|..:...|. ::.:..:.|.:.||.
plant   291 LKPNKDKFIRDVIFSLVLAGRDTTSSVLTWFFWLLSKHPQVMAKLRHEINTKFDNEDLEKLVYLH 355

  Fly   353 AVIKETLRIYPSVPFFSRKVLE-DLEVGKLTVPKGASISCLIYMLHR-------DPKNFPDPERF 409
            |.:.|::|:||.:||..:...: |:......|...:.|...||.|.|       |..:| .|||:
plant   356 AALSESMRLYPPLPFNHKSPAKPDVLPSGHKVDANSKIVICIYALGRMRSVWGEDALDF-KPERW 419

  Fly   410 DPDRFLVNEKQMH--PFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAE 472
            ..|    |....|  .:.|.||::|||.|:|:..|:|::|.....::|:|.|...:.|:.:|:..
plant   420 ISD----NGGLRHEPSYKFMAFNSGPRTCLGKNLALLQMKMVALEIIRNYDFKVIEGHKVEPIPS 480

  Fly   473 LVTKSGNGIRLRI 485
            ::.:..:|:::.:
plant   481 ILLRMKHGLKVTV 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 107/472 (23%)
CYP96A15NP_176086.1 PLN02169 1..497 CDD:177826 116/533 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.