DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP97A3

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:459 Identity:121/459 - (26%)
Similarity:221/459 - (48%) Gaps:47/459 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LKELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNN-QLLTKSRNYELLEPWLGKGLLTNGGES 119
            |.||...:|.:||:.||....::.:||...|.:|.:| :..:|....|:|:..:||||:...||.
plant   132 LYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAYSKGILAEILDFVMGKGLIPADGEI 196

  Fly   120 WHRRRKLLTPGFHFR----ILSEFKEPMEENCRILVRRLRTKA-NGESFDIYPYITLFALDAICE 179
            |.|||:.:.|..|.:    ::|.|.|..:..|    ::|...| .||..::....:...||.|.:
plant   197 WRRRRRAIVPALHQKYVAAMISLFGEASDRLC----QKLDAAALKGEEVEMESLFSRLTLDIIGK 257

  Fly   180 TAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFS---FWQRLNVFFKHTKPGKEREA-ALKVLHD 240
            ..... ....|.:|:..::||.::.|....:|.|   .|.  ...:|...|.:.:.| :||:::|
plant   258 AVFNY-DFDSLTNDTGVIEAVYTVLREAEDRSVSPIPVWD--IPIWKDISPRQRKVATSLKLIND 319

  Fly   241 ETNRVI----RLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEV 301
            ..:.:|    |:..|:.:|...|:..|         |..:.|..||.:    |.::|...:|:::
plant   320 TLDDLIATCKRMVEEEELQFHEEYMNE---------RDPSILHFLLAS----GDDVSSKQLRDDL 371

  Fly   302 DTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEG------REKESMPYLEAVIKETLR 360
            .|.:..||:|:::.:.:...||:..|.|..:..||...:.|      ::.:.:.|...|:.|:||
plant   372 MTMLIAGHETSAAVLTWTFYLLTTEPSVVAKLQEEVDSVIGDRFPTIQDMKKLKYTTRVMNESLR 436

  Fly   361 IYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLV-----NEKQ 420
            :||..|...|:.:::..:|:..:.:|..|...::.|||.|.::.|.|:|:|:|:.:     ||..
plant   437 LYPQPPVLIRRSIDNDILGEYPIKRGEDIFISVWNLHRSPLHWDDAEKFNPERWPLDGPNPNETN 501

  Fly   421 MHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVT-KSGNGIRLR 484
            .: |::..|..|||.|||..||..|...::|||:|.:.|.......|..:....| .:..|::|.
plant   502 QN-FSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQIAPGAPPVKMTTGATIHTTEGLKLT 565

  Fly   485 ILPR 488
            :..|
plant   566 VTKR 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 117/437 (27%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 121/459 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 1 0.900 - - OOG6_100014
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.