DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP72C1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:216 Identity:53/216 - (24%)
Similarity:84/216 - (38%) Gaps:68/216 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALVAFVLWAA----FLRYLPKIL-NFLRLQRF---------------------AKTLPGPTIGE 42
            |.|:...:|.|    :||  ||.| .:|:.|.|                     |.:||.|...:
plant    16 LILILNWVWRAVNWVWLR--PKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPLDAD 78

  Fly    43 LIANVKKGEILNWLKELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTK----SRNYEL 103
            .:.     .::.:|.....|||.....|:|....|:..|||.:::::..::|..|    |.|:..
plant    79 FLP-----RMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIMSKHELFPKPKIGSHNHVF 138

  Fly   104 LEPWLGKGLLTNGGESWHRRRKLLTPGFHF----RILSEF----KEPMEE--------------- 145
            |     .|||.:.|..|.:.|.:|.|.|..    .||..|    ||.:||               
plant   139 L-----SGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTMELDS 198

  Fly   146 --NCRILVRRLRTKAN-GESF 163
              :|..|.|.:..:|: |:|:
plant   199 WTHCHDLTRNMLARASFGDSY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 40/159 (25%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.