DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP71A18

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001184964.1 Gene:CYP71A18 / 837705 AraportID:AT1G11610 Length:504 Species:Arabidopsis thaliana


Alignment Length:517 Identity:119/517 - (23%)
Similarity:216/517 - (41%) Gaps:113/517 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPKILNFLRLQRFAKTL-------PGPTIGELIANVKKGEI--LNWLKELREKHGPVFRIWFGKD 74
            |..:|..|.|::|.|..       |.|....:|.|:.:..:  ...|..|..::||:..:.||:.
plant    11 LTTLLTLLLLKKFLKRTAKKVNLPPSPWRIPVIGNLHQLSLHPHRSLHSLSLRYGPLMLLHFGRV 75

  Fly    75 LMVMFTDPEDIKQLLGNNQL----LTKSRNYELLEPWLGKGLLTNG--------GESWHRRR--- 124
            .:::.:..|...::|..:.|    ..||:...        ||:..|        ||.|.:.:   
plant    76 PILVVSSSEAAHEILKTHDLKFANRPKSKAVH--------GLMNGGRDVVFGPYGEYWRQMKSVC 132

  Fly   125 --KLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGES-----FDIYPYITLFALDAIC---- 178
              .|||.    ::::.|::..||....::.:|. ||:..|     .:::..:|......:.    
plant   133 ILNLLTN----KMVASFEKVREEEVNAMMEKLE-KASCSSSAENLSELFVTLTSDVTSRVSLGKK 192

  Fly   179 ----ETAMGIKKHAQLQSD-------SEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKERE 232
                |||.|:||..:...:       .:||.|:..|            .|:|.|..         
plant   193 YWEDETAGGLKKRVRQIMELLREFPIGDYVPALAWI------------DRINGFNS--------- 236

  Fly   233 AALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQME--GGAELSDT 295
               |::  |.:|......|:::||..|          ..:.:..|:::||..:.|  .|.::...
plant   237 ---KIV--EVSRAYSDLMEKVVQEHLE----------AGEHKADFVNILLSIEKEKNNGFKVQRN 286

  Fly   296 DIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEE--------ASELEGREKESMPYLE 352
            ||:..:......|..|:|:.:.:.::.|.:||:..::...|        .|.::.:|.|:|.||:
plant   287 DIKFMILDMFIGGISTSSTLLEWIMTELIRNPECMKKLQNEIRSTIRPHGSYIKEKEVENMRYLK 351

  Fly   353 AVIKETLRIYPSVPFFSRKVL-EDLEVGKLTVPKGASISCLIYMLHRDPKNF-PDPERFDPDRFL 415
            |||||..|::|.:|....::| ||::|....:..|..:....:.:||||..: ||.|.|.|:|.|
plant   352 AVIKEVFRVHPPLPLILPRLLTEDVKVKGYDIAAGTEVLINAWSIHRDPAIWGPDAEEFKPERHL 416

  Fly   416 VNEKQMH--PFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPD---KDHQPKPLAE 472
            .:....|  ...:..|.:|.|.|.|...||..::.:||.|:..:.:..|   ...|| .|||
plant   417 DSTLDYHGQDLKYIPFGSGRRICPGINLAMGLVEVTLANLVGRFDWSVDPGPNGDQP-DLAE 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 110/496 (22%)
CYP71A18NP_001184964.1 p450 26..496 CDD:299894 113/502 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.