DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP96A4

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:508 Identity:115/508 - (22%)
Similarity:206/508 - (40%) Gaps:99/508 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPKILNFLRLQRFAKTLPGPTIGELIANVKKGEILNWLKELREKHGPVFRIWFGKDLMVMFTDPE 83
            :|:|.:|:.....|:.:.|..||.            ||.              |.|:: :..||.
plant    50 IPRIYDFVTEALEAENMTGCFIGP------------WLS--------------GTDIL-LTVDPV 87

  Fly    84 DIKQLLGNNQL-LTKSRNYELLEPWLGKGLLTNGGESWHRRRKLLTPGF------HFRI------ 135
            :|:.:|.:|.: ..|.:.:..:..:||.|:.......|...|......|      .|.:      
plant    88 NIQYILSSNFVNYPKGKKFNKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSHQDFQSFSVSTSVSK 152

  Fly   136 LSEFKEPMEENC---RILVRRLRTKANGESFDIYPYITLFALDAICETAMGI--KKHAQLQSDSE 195
            ||:...|:.:|.   .|||            |:......|..|.......|.  |..:......|
plant   153 LSQGLVPILDNAVEKHILV------------DLQDLFQRFLFDTSSTLMAGYDPKSLSVEMPKVE 205

  Fly   196 YVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPG--------------KEREAALKVLHDETNRVI 246
            :..|:..:...|             |::|.||.              |:....|.|......::|
plant   206 FADAMDGVADAM-------------FYRHLKPAFLWSIQSWIGVGIEKKMRRGLDVFDQMLGKII 257

  Fly   247 RLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDT 311
            ..:||: |:.......:.|..||     |.:...:..|:.:.....:|..||:.:...:....||
plant   258 SAKREE-IKNHGIHDSKGEAMDV-----LTYYMTIDTTKYKHLKPSNDKFIRDTILGLVIAARDT 316

  Fly   312 TSSAIAFALSLLSKNPD----VQQRAFEEASELEGREKESMPYLEAVIKETLRIYPSVPFFSRKV 372
            ||||:.:...||||||:    ::|...::..:.:..:.:.:.||:..:.||||:||||||..:..
plant   317 TSSALTWFFWLLSKNPEAMTKIRQEINKKMPKFDPADLDKLVYLDGAVCETLRLYPSVPFNHKSP 381

  Fly   373 LE-DLEVGKLTVPKGASISCLIYMLHRDPKNF-PDPERFDPDRFLVNE---KQMHPFAFAAFSAG 432
            .: |:......|.|...:...||.|.|....: .|.|.|.|:|::.:.   :|...:.|.||:||
plant   382 AKPDVLPSGHKVDKNWRVVIPIYSLGRMKSVWGDDAEDFRPERWISDSGMLRQESSYKFLAFNAG 446

  Fly   433 PRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRLRI 485
            ||.|:|::...|::||....::|:|.....:.|:|||:..::.:..:|:::.:
plant   447 PRTCLGKRLTFLQMKTVAVEIIRNYDIKVVEGHKPKPVPSVLLRMQHGLKVSV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 108/474 (23%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 115/508 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.