DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and AT5G51900

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_200003.1 Gene:AT5G51900 / 835265 AraportID:AT5G51900 Length:242 Species:Arabidopsis thaliana


Alignment Length:299 Identity:55/299 - (18%)
Similarity:106/299 - (35%) Gaps:93/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 FKHTKP------------GKERE--AALKVLHDETNRVIRLRREQL----IQERNEWKPEAEQDD 268
            ::|.||            |.|::  .|..:......:.|..|||::    :...:.:..::..:.
plant     2 YRHVKPRFSWKLQSWIGVGMEKKMIEAGAIFDRVCGKYISARREEVKRSQVNNNDHFIRDSHANL 66

  Fly   269 VGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRA 333
            :.:..:|......||.      .::|..:|:.|...:..|.|||:||:.:....||:||.|..:.
plant    67 LTSHIKLDTTQYQLLD------PINDKFLRDNVFALLLAGRDTTASALTWFFWFLSENPLVVTKI 125

  Fly   334 FEEAS-----ELEGREKESMPYLEAVIKE--------TLRIYP-SVPFFSRKVLEDLEVGKLTVP 384
            .:|..     ...|:|:.|...:|.:.|:        .:||.. .:.|..|:|            
plant   126 RQEIDMNLPRSCSGQERPSCDPMEYLNKDDESCMGRRCIRIQAREMDFRDRRV------------ 178

  Fly   385 KGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHPFAFAAFSAGPRNCIGQKFAMLELKTS 449
               ||.|                                        ..|.|.|::.||:::|..
plant   179 ---SIQC----------------------------------------RSRICHGKQRAMVQMKIV 200

  Fly   450 LAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRLRILPR 488
            ...:|::|........:.:|...|:.|..:|.:::|..|
plant   201 AVEILQNYDIKVANGQKFEPDTSLILKMKHGFKVKINKR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 49/278 (18%)
AT5G51900NP_200003.1 p450 <2..239 CDD:299894 54/297 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.