DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CPD

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_196188.1 Gene:CPD / 830453 AraportID:AT5G05690 Length:472 Species:Arabidopsis thaliana


Alignment Length:502 Identity:125/502 - (24%)
Similarity:198/502 - (39%) Gaps:113/502 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WAAFLRYLPKI----LNFLRLQRFAK--TLPG----PTIGE---LIANVKKGEILNWLKELREKH 63
            :.|||..|..|    |..||..|:.:  ..||    |.|||   ||...|......::.|...::
plant     3 FTAFLLLLSSIAAGFLLLLRRTRYRRMGLPPGSLGLPLIGETFQLIGAYKTENPEPFIDERVARY 67

  Fly    64 GPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEP-----WLGKG--LLTNGGESWH 121
            |.||......:..:...|||..:.:|.|     :.:.:|...|     .|||.  ||..|  |.|
plant    68 GSVFMTHLFGEPTIFSADPETNRFVLQN-----EGKLFECSYPASICNLLGKHSLLLMKG--SLH 125

  Fly   122 RRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIKK 186
            :|...||  ..|...|..|:.:..:...|||                   |.||:.....:    
plant   126 KRMHSLT--MSFANSSIIKDHLMLDIDRLVR-------------------FNLDSWSSRVL---- 165

  Fly   187 HAQLQSDSEYVQAVQSICRVMHKQSFSF----WQR---------LNVFFKHTKP------GKERE 232
               |..:::.:....::     ||..||    |..         :..||....|      .|..:
plant   166 ---LMEEAKKITFELTV-----KQLMSFDPGEWSESLRKEYLLVIEGFFSLPLPLFSTTYRKAIQ 222

  Fly   233 AALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDML--LLTQMEGGAELSDT 295
            |..||.  |...|:.::|.             |:::.||:|:   .|||  ||...:|   .||.
plant   223 ARRKVA--EALTVVVMKRR-------------EEEEEGAERK---KDMLAALLAADDG---FSDE 266

  Fly   296 DIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEE----------ASELEGREKESMPY 350
            :|.:.:...:..|::|||:.:..|:..|::.|....:..||          :..||..:.:|||:
plant   267 EIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSDSYSLEWSDYKSMPF 331

  Fly   351 LEAVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFL 415
            .:.|:.||||:...:....|:.:.|:|:....:|||..:......:|.||.:|.|...|:|.|:.
plant   332 TQCVVNETLRVANIIGGVFRRAMTDVEIKGYKIPKGWKVFSSFRAVHLDPNHFKDARTFNPWRWQ 396

  Fly   416 VNEKQMHPF-AFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLP 461
            .|.....|. .|..|..|||.|.|.:.|.:.|...|..|:..:.::|
plant   397 SNSVTTGPSNVFTPFGGGPRLCPGYELARVALSVFLHRLVTGFSWVP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 116/473 (25%)
CPDNP_196188.1 p450 1..472 CDD:386267 125/502 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.