DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP81D3

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_195451.1 Gene:CYP81D3 / 829889 AraportID:AT4G37340 Length:500 Species:Arabidopsis thaliana


Alignment Length:244 Identity:64/244 - (26%)
Similarity:111/244 - (45%) Gaps:28/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 LIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSAIA 317
            |:.||.|.|         .||:...:|.||..|.......:|..|:..:.:.:..|.||::..:.
plant   255 LVDERREGK---------EKRQNTMVDHLLCLQETQPEYYTDNIIKGIMLSLILAGTDTSAVTLE 310

  Fly   318 FALSLLSKNPDVQQRAFEEASE-------LEGREKESMPYLEAVIKETLRIYPSVPFFSRKVL-E 374
            :.||.|..:|.:..:|.:|...       :|..:...:|||:.::.|:||:||:.|.....|. |
plant   311 WTLSALLNHPQILSKARDEIDNKVGLNRLVEESDLSHLPYLQNIVSESLRLYPASPLLVPHVASE 375

  Fly   375 DLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHPFAFAAFSAGPRNCIGQ 439
            |.:||...:|:|..:....:.:|||||.:.||..|.|:||   ||:........|..|.|.|.|.
plant   376 DCKVGGYHMPRGTMLLTNAWAIHRDPKIWDDPTSFKPERF---EKEGEAQKLLGFGLGRRACPGS 437

  Fly   440 KFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRLRILPR 488
            ..|......::..|::.:.:....:.:..     :|:.|.|:   |:|:
plant   438 GLAQRLASLTIGSLIQCFEWERIGEEEVD-----MTEGGGGV---IMPK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 59/223 (26%)
CYP81D3NP_195451.1 p450 5..489 CDD:299894 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.