DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP702A8

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_189648.1 Gene:CYP702A8 / 822729 AraportID:AT3G30290 Length:408 Species:Arabidopsis thaliana


Alignment Length:460 Identity:108/460 - (23%)
Similarity:173/460 - (37%) Gaps:130/460 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NFLRLQRFAKTLPGPTIGELIANVKKGEILNWLKELREKHGPVFRIWFGKDLMVMFTDPEDIK-Q 87
            |.|.:: .|||...|.|.:.||.: .||..|...:..|.|..|      ::|.|.....:.:| :
plant    20 NELNME-MAKTNRTPGITKSIARL-FGEDNNLFLQSTESHKHV------RNLTVQMLGSQSLKLR 76

  Fly    88 LLGNNQLLTKSRNYELLEPWLGKGLLTNGGESWHRRRKLLTPGFHFRILSEFKEPMEENCRILVR 152
            ::.|..|||::.                                           |||..|    
plant    77 IMENIDLLTRTH-------------------------------------------MEEGAR---- 94

  Fly   153 RLRTKANGESFDIYPYITLFALDAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQR 217
                  :| |.|:....:...::.:.:..||       :.:.|..:.:....|...    |.|.|
plant    95 ------DG-SLDVKETTSKILIECLAKKVMG-------EMEPEAAKKLALCWRYFP----SGWFR 141

  Fly   218 LNVFFKHTKPG-------KEREAALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRL 275
            |    ....||       |.|:           |:..|.:|:::::|.            |....
plant   142 L----PFNLPGIGVYNMMKARK-----------RMKTLLKEEVLKKRE------------AGEEF 179

  Fly   276 AFLDMLLLTQMEGGAE-LSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQR------- 332
            .....::..:.||..| :|..::.|.:.||....::||...:|..:..:|:||.|.|.       
plant   180 GEFSKIIFGEKEGEKETMSMKNVIEYIYTFFVIANETTPRILAATVKFISENPKVMQELQREHAM 244

  Fly   333 AFEEASELEG---REKESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIY 394
            .||..||..|   .:.:||.:...||.|:|||..:||...||...|.:||..|:|.|.:     :
plant   245 IFENKSEEAGLTWEDYKSMTFTNMVINESLRISTTVPVILRKPDHDTKVGDYTIPAGWN-----F 304

  Fly   395 M----LHRDPKNFPDPERFDPDRFLVNE-KQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLL 454
            |    .|.||..:.||..|:|.|:..|: ..:....:..|.||||.|:|..||.|.:...:..|.
plant   305 MGYPSAHFDPTKYEDPLEFNPWRWKGNDLDAIVSTNYIPFGAGPRLCVGAYFAKLLMAIFIHHLC 369

  Fly   455 RSYRF 459
            | ||:
plant   370 R-YRW 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 103/449 (23%)
CYP702A8NP_189648.1 p450 5..374 CDD:299894 108/460 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.