DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and cyp4f2

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:506 Identity:157/506 - (31%)
Similarity:269/506 - (53%) Gaps:54/506 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVAFVLWAAFLRYLPK------ILNFLRLQRFAKTLPGPT-IGELIANVKKGEILNWLKELREKH 63
            :.|:::.|..||..|:      :|..|.:  |..|..|.| |...|.|::: .:|.||       
 Frog    46 IYAYIINARRLRCFPEPPRRSWLLGHLGM--FMPTEEGLTEISSAICNLRR-TLLTWL------- 100

  Fly    64 GPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRN--YELLEPWLGKGLLTNGGESWHRRRKL 126
            ||:..        |....|:.:|.::..:..:.....  |..|.||||.|||.:.||.|.:.|:|
 Frog   101 GPIPE--------VSLVHPDTVKPVVAASAAIAPKDELFYGFLRPWLGDGLLLSRGEKWGQHRRL 157

  Fly   127 LTPGFHFRILSEFKEPMEENCRILVRRLR--TKANGESFDIYPYITLFALDAICETAMGIKKHAQ 189
            |||.|||.||..:.:...::..|::.:.|  |.....|.|::.:::|..||.:.:.........|
 Frog   158 LTPAFHFDILKNYVKIFNQSTDIMLAKWRRLTAEGPVSLDMFEHVSLMTLDTLLKCTFSYDSDCQ 222

  Fly   190 LQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQLI 254
             :..|:|:.|:..:..::.|:........:..:..:..|::...|.|.:|:.|..|:: :|::.:
 Frog   223 -EKPSDYISAIYELSSLVVKREHYLPHHFDFIYNLSSNGRKFRQACKTVHEFTAGVVQ-QRKKAL 285

  Fly   255 QER--NEW--KPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSA 315
            ||:  .||  ..:.:..|        |:|:|||::.|.|::|||.|:|.|||||||||||||:|.
 Frog   286 QEKGMEEWIKSKQGKTKD--------FIDILLLSKNEDGSQLSDEDMRAEVDTFMFEGHDTTASG 342

  Fly   316 IAFALSLLSKNPDVQQRAFEEASE-LEGR--------EKESMPYLEAVIKETLRIYPSVPFFSRK 371
            :::.|..|:.:|:.|::..:|.:| |||:        |...:|:....|||:||::|.|....|:
 Frog   343 LSWILYNLACHPEYQEKCRKEITELLEGKDIKHLEWDELSKLPFTTMCIKESLRLHPPVVAVIRR 407

  Fly   372 VLEDLEVGKLTV-PKGASISCLIYMLHRDPKNFPDPERFDPDRF-LVNEKQMHPFAFAAFSAGPR 434
            ..||:::.|..: |||......|:.:|.:|..:|:|:.:||.|| ..|.::...:||..||||||
 Frog   408 CTEDIKLPKGDILPKGNCCIINIFGIHHNPDVWPNPQVYDPYRFDPENLQERSSYAFVPFSAGPR 472

  Fly   435 NCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRLRI 485
            |||||.|||.|:|..||::|.:::...|:....:...||:.::.||:.|::
 Frog   473 NCIGQNFAMAEMKIVLALILYNFQVRLDETKTVRRKPELILRAENGLWLQV 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 143/453 (32%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 150/480 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.