DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp4a1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_787031.1 Gene:Cyp4a1 / 50549 RGDID:68945 Length:509 Species:Rattus norvegicus


Alignment Length:513 Identity:172/513 - (33%)
Similarity:264/513 - (51%) Gaps:65/513 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RYLPKILNFLRLQRFAKTLPGPTIGELIANVKKGEIL---NW-LKELREKHGPVFRIWFG----- 72
            |:...|..||::        ...:|.|:..||..:..   .| ||..::...|.|..:||     
  Rat    10 RFTGSISGFLQV--------ASVLGLLLLLVKAVQFYLQRQWLLKAFQQFPSPPFHWFFGHKQFQ 66

  Fly    73 --KDLMVMFT-----------------------DPEDIKQLLGNNQLLTKSRN-YELLEPWLGKG 111
              |:|..:.|                       ||:.:|.:||.:.  .|:.. |.||.||:|.|
  Rat    67 GDKELQQIMTCVENFPSAFPRWFWGSKAYLIVYDPDYMKVILGRSD--PKANGVYRLLAPWIGYG 129

  Fly   112 LLTNGGESWHRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGE-SFDIYPYITLFALD 175
            ||...|:.|.:.|::|||.||:.||..:.:.|.::.|:::.:....|..: |.:|:.:|:|..||
  Rat   130 LLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLDKWEQLAGQDSSIEIFQHISLMTLD 194

  Fly   176 AICETAMGIKKHAQLQSD-SEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLH 239
            .:.:.|.......|:..: ..|:||:.::..:.|.:..:.:.:.:..:..:..|.....|.::.|
  Rat   195 TVMKCAFSHNGSVQVDGNYKSYIQAIGNLNDLFHSRVRNIFHQNDTIYNFSSNGHLFNRACQLAH 259

  Fly   240 DETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTF 304
            |.|:.||:||::||       :...|.:.|..||||.|||:|||.:||.|..|||.|:|.|||||
  Rat   260 DHTDGVIKLRKDQL-------QNAGELEKVKKKRRLDFLDILLLARMENGDSLSDKDLRAEVDTF 317

  Fly   305 MFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEG-------REKESMPYLEAVIKETLRIY 362
            ||||||||:|.:::....|:.:|:.|||..||...:.|       ...:.:||....|||.||:|
  Rat   318 MFEGHDTTASGVSWIFYALATHPEHQQRCREEVQSVLGDGSSITWDHLDQIPYTTMCIKEALRLY 382

  Fly   363 PSVPFFSRKVLEDLEV--GKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHPFA 425
            |.||...|::...:..  |: ::|||..::..||.||.:||.:|:||.|||.|| ..:...|..:
  Rat   383 PPVPGIVRELSTSVTFPDGR-SLPKGIQVTLSIYGLHHNPKVWPNPEVFDPSRF-APDSPRHSHS 445

  Fly   426 FAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRL 483
            |..||.|.|||||::|||.|:|..:|:.|..:..|||....|.||..||.||.|||.|
  Rat   446 FLPFSGGARNCIGKQFAMSEMKVIVALTLLRFELLPDPTKVPIPLPRLVLKSKNGIYL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 158/479 (33%)
Cyp4a1NP_787031.1 p450 52..503 CDD:278495 160/461 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.