DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp6a22

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster


Alignment Length:453 Identity:116/453 - (25%)
Similarity:194/453 - (42%) Gaps:84/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 MVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTN-------------GGESWHRRRKLL 127
            :|:.||.|..||:     |:....|:|      .:|:..|             .|..|...|:.:
  Fly    80 VVLVTDLELAKQI-----LIQDFANFE------DRGMYHNERDDPLTGHLFRIDGPKWRPLRQKM 133

  Fly   128 TPGF-------HFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIK 185
            :|.|       .|..:.|..|.:.:.|    ..|...|.....:|...:..:..|.|...|.|::
  Fly   134 SPTFTSAKMKYMFPTVCEVGEELTQVC----GELADNAMCGILEIGDLMARYTSDVIGRCAFGVE 194

  Fly   186 KHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVF--FKHTKPGKEREAALKVLH-DETNRVIR 247
            .:.....::|:.        :|.:::||..:...:.  |..:.|...|...::.:| |.|:..:.
  Fly   195 CNGLRNPEAEFA--------IMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIHQDITDFYVG 251

  Fly   248 LRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTT 312
            :.||.:       |...||..|    |..|:::|:  :|:...||:..::..:...|...|.||:
  Fly   252 IVRETV-------KQREEQGIV----RSDFMNLLI--EMKQRGELTIEEMAAQAFIFFAAGFDTS 303

  Fly   313 SSAIAFALSLLSKNPDVQQRAFEE---ASELEGRE-----KESMPYLEAVIKETLRIYPSVPFFS 369
            :|.:.|||..|:|.|.:|.:..||   |..|...|     .:.:.|:|.||.||||.||.:|..:
  Fly   304 ASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQLT 368

  Fly   370 RKVLEDLEVGK----LTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHP-FAFAAF 429
            | :...|...|    ..:..|..:...:|.:|.||..:|:|.:|.|:|||.::....| .|:..|
  Fly   369 R-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPF 432

  Fly   430 SAGPRNCIGQKFAMLELKTSLAMLLRSYRF--LPDKDHQPKPLAELVTKS-----GNGIRLRI 485
            ..|||||||.:|..::....|..|||::.|  .|..|    |..|.:..:     .|||.|::
  Fly   433 GDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTD----PKIEFLKSNILLCPANGIYLKV 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 110/430 (26%)
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 116/451 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.