DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and AgaP_AGAP008553

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_001237584.1 Gene:AgaP_AGAP008553 / 4578315 VectorBaseID:AGAP008553 Length:127 Species:Anopheles gambiae


Alignment Length:123 Identity:43/123 - (34%)
Similarity:70/123 - (56%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FGKDLM---------VMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGGESWHRRRKL 126
            :||.|:         :...|.:.|.|:: ..:.:.|:..|:.:.||||.||:.:.|..|.:.||:
Mosquito     6 YGKTLITQSLFNFPSIHVCDAKVIGQIM-QARTIEKTIIYDFMTPWLGTGLIVSTGSKWTQHRKI 69

  Fly   127 LTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGI 184
            :||.|||:||.:|...|.....:|:.:|:|.|||...:||.::|..|||.|.|:||.:
Mosquito    70 ITPAFHFKILEDFLVIMNHQSDVLIEKLKTSANGTDCNIYNHVTYCALDIIAESAMSV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 43/123 (35%)
AgaP_AGAP008553XP_001237584.1 p450 30..>127 CDD:299894 38/97 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.