DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp313a1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster


Alignment Length:512 Identity:128/512 - (25%)
Similarity:233/512 - (45%) Gaps:73/512 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTLALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGPTIGELIANVKKGEILNWLKELR----- 60
            ::.|..|..:.|..|| :..:.|.||.|:     :||| ||..|.......|:.:.::|.     
  Fly     4 INLLLAVGALFWIYFL-WSRRRLYFLMLK-----IPGP-IGLPILGSSLENIITYKRKLSFRTKY 61

  Fly    61 -EKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRN-YELLEPWLGKGLLTNGGESWHRR 123
             .|:|.....|.|....::..||:.::.:..:.....||:: ...:...:|.|||......|..|
  Fly    62 LNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDR 126

  Fly   124 RKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIK-KH 187
            ||...|.|...:|..|....:...::|:..|.|..:....|:.|.:..::.....:|.||.: ||
  Fly   127 RKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVKH 191

  Fly   188 AQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVL------HDETNRVI 246
            .:...:...|::.:|:  :.|       ..||:..    |..:.....|:.      .|..:|:.
  Fly   192 DEHFKNGSLVESFESL--ISH-------STLNILM----PLVQNRMISKICGYDKLRADNFSRIQ 243

  Fly   247 RLRREQLIQERNEWKPEAEQD---DVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEG 308
            :: .:.::.::....|:.:.|   ::...|.:         ::....:::..|::.|....:..|
  Fly   244 KM-LDNVVNKKVNPLPKTDSDPESNIVINRAM---------ELYRKGDITYMDVKSECCIMIAAG 298

  Fly   309 HDTTSSAIAFALSLLSKNPDVQQRAFEEASELEG------------REKESMPYLEAVIKETLRI 361
            :||::..:..||.||:.:|:.|:..||   ||.|            .:.:.:.|||.|||||||:
  Fly   299 YDTSALTVYHALFLLANHPEHQEAVFE---ELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRL 360

  Fly   362 YPSVPFFSRKVLEDLEVGK-LTVPKGASISCLIYMLHRDPKNF-PDPERFDPDRFLV-NEKQMHP 423
            .|::|..:|:...|:.:.. :.:|||..|...::..||:|:.: ||.:.|:||.||. |.:|.||
  Fly   361 IPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHP 425

  Fly   424 FAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRF--------LPDKDHQPKPLAE 472
            :|:..|:.|.|||||.|:||:..|.:|..:||:|:.        |...|:....|||
  Fly   426 YAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAE 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 116/473 (25%)
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 114/456 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
54.860

Return to query results.
Submit another query.