DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp313a3

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster


Alignment Length:493 Identity:124/493 - (25%)
Similarity:219/493 - (44%) Gaps:69/493 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGPTIGELIANVKKGEILNWLKE--LREK---- 62
            |..|....|..||      .:..||......:||| :|..|..:....::.:.::  :|.|    
  Fly     7 LLAVGVCFWIYFL------WSRRRLYMMHFKIPGP-MGLPILGIAFEYLITYKRKMSIRTKYMDI 64

  Fly    63 HGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNY-ELLEPWLGKGLLTNGGESWHRRRKL 126
            :|....:|.|....|:..||:..:::..:.:.|.:|..: :.:....|.|||:.....|..|||.
  Fly    65 YGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKN 129

  Fly   127 LTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMG--IKKHAQ 189
            |.|.|...:|..|........:.||..|.:........:...|..::.....:|.:|  :||.|.
  Fly   130 LNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVGTDVKKDAS 194

  Fly   190 LQSDSEYVQAVQSICRVM---------HKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRV 245
            .::|| .:::.::..:::         |.:.||           |..|.|.:.||  .....|::
  Fly   195 FKNDS-VLKSYETFMKIIVMNVLLPFTHNKIFS-----------TLGGFETQKAL--AKSNVNKM 245

  Fly   246 IRLRREQLIQERNEWKPEA-EQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGH 309
            |    ..::.::...|||: .|.::.:....|.       ::....|:|..:::.|..:|:....
  Fly   246 I----GTIVDKKLMTKPESGSQPEITSVINKAI-------ELHRNGEMSREEVQSECCSFVVAAF 299

  Fly   310 DTTSSAIAFALSLLSKNPDVQQRAFEEASEL---------EGREKESMPYLEAVIKETLRIYPSV 365
            :||...:..||.||:..|:.|...::|..||         ...:.:.|.:||.|:.||||:.|||
  Fly   300 ETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRLIPSV 364

  Fly   366 PFFSRKVLEDLEVGK-LTVPKGASISCLIYMLHRDPKNF-PDPERFDPDRFLV-NEKQMHPFAFA 427
            ||..|:.:.|..:.. :.:|||..|...|:..||:..:: .||..|:||.||. |.:..||:|:.
  Fly   365 PFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYI 429

  Fly   428 AFSAGPRNCIGQKFAMLELKTSLAMLLR------SYRF 459
            .||.|.|||||.|:.::..|.:|:.:||      |:|:
  Fly   430 PFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRY 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 117/462 (25%)
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 115/455 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.