DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and cyp4t8

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_954686.2 Gene:cyp4t8 / 387527 ZFINID:ZDB-GENE-031219-3 Length:509 Species:Danio rerio


Alignment Length:508 Identity:183/508 - (36%)
Similarity:275/508 - (54%) Gaps:58/508 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FLRYLPKILNFLRLQR-FAKTL---PGPTIGELIANVKK--------GEILNWLKELREKHGPVF 67
            ||..|..::..|.::| ..||:   |||....|..:||:        .:|:.|:    |.:...|
Zfish    21 FLACLLTVVKLLIVRRKGVKTMERFPGPPAHWLFGHVKEFRQDGHDLEKIVKWM----ELYQFAF 81

  Fly    68 RIWFGKDLMVM-FTDPEDIKQLLGNNQLLTKSRN---YELLEPWLGKGLLTNGGESWHRRRKLLT 128
            .:|||..|.|: ...|..:|.:|    ..|:.::   |:...||||.|||.:.|:.|.|.|:|||
Zfish    82 PLWFGPSLAVLNIHHPSYVKTIL----TTTEPKDDYAYKFFIPWLGDGLLVSTGQKWFRHRRLLT 142

  Fly   129 PGFHFRILSEFKEPMEENCRILVRRLRTKANG-ESFDIYPYITLFALDAICETAMGIKKHAQLQS 192
            ||||:.:|..:.:.:.::.::::.:....:.. |||:::.:::|..||:|.:.|.....:.|..|
Zfish   143 PGFHYDVLKPYVKLISDSTKVMLDKWEVHSRSEESFELFKHVSLMTLDSIMKCAFSCNSNCQTDS 207

  Fly   193 DSE-YVQAVQSICRVMHKQSFSFWQRLNVFFKHTKP-------GKEREAALKVLHDETNRVIRLR 249
            .:. |:|||..:|.:::       .|..||..|:|.       |.....|..:.|:.|..|||.|
Zfish   208 GTNPYIQAVFDLCHLVN-------LRFRVFPYHSKAIFHLSPHGYRFRKAASIAHNHTAEVIRKR 265

  Fly   250 REQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSS 314
            :|.|       |.|.||..|..:|.|.|||:||..:.|....|||.|||.|||||||||||||:|
Zfish   266 KEVL-------KMEEEQGIVKNRRYLDFLDILLSARDEHQQGLSDEDIRAEVDTFMFEGHDTTAS 323

  Fly   315 AIAFALSLLSKNPDVQ-------QRAFEEASELEGREKESMPYLEAVIKETLRIYPSVPFFSRKV 372
            .|::....|:.||:.|       |:|.:..:.||..:...:||....|||:||::|.||..|||:
Zfish   324 GISWIFYNLACNPEHQEKCRQEIQQALDGKATLEWEDLNKIPYTTMCIKESLRLHPPVPGISRKL 388

  Fly   373 LEDLEV--GKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFL-VNEKQMHPFAFAAFSAGPR 434
            .:.|..  |: |||:|.:|...||.:|.:...:.:|.:|||.||| .|.....|.||..||||||
Zfish   389 TKPLTFFDGR-TVPEGCTIGVSIYGIHMNSTVWENPYKFDPLRFLPENVANRSPHAFVPFSAGPR 452

  Fly   435 NCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRLRILP 487
            |||||.|||.|:|.::|:.|:.|..:.|.||.||.:.::|.:|.|||.::|.|
Zfish   453 NCIGQNFAMNEMKVAVALTLKRYYLIKDPDHTPKMIPQVVLRSLNGIHIKIKP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 168/467 (36%)
cyp4t8NP_954686.2 p450 46..501 CDD:306555 174/477 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.