DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp11b3

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_861545.1 Gene:Cyp11b3 / 353498 RGDID:727886 Length:498 Species:Rattus norvegicus


Alignment Length:485 Identity:107/485 - (22%)
Similarity:187/485 - (38%) Gaps:105/485 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ELIANVKKGEILNWLKELREKH---------------GPVFRIWFGKDLMVMFTDPEDIKQLLGN 91
            |.|....:.:.|..::.|||:.               ||:||...|...:|....|||.::|...
  Rat    38 EAIPQYSRNKWLKMIQILREQSQENLHLEMHQAFQELGPIFRHSAGGAQIVSVMLPEDAEKLHQV 102

  Fly    92 NQLLTKSRNYELLEPW--------LGKGLLTNGGESWHRRRKLLTPG------------FHFRIL 136
            ..:|.:...   ||.|        |.:|:....|..|...|..|.|.            |...:.
  Rat   103 ESILPRRMT---LESWVAHRELRGLRRGVFLLNGADWRFNRLQLNPNMLSPKAVQSFVPFVDVVA 164

  Fly   137 SEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDA----ICETAMGIKKHAQLQSDSEYV 197
            .:|.|.:::      |.|.......|.||...:..:.::|    |....:|:..|.......:::
  Rat   165 RDFVENLKK------RMLENVHGSMSMDIQSNVFNYTMEASHFVISGERLGLTGHDLNPESLKFI 223

  Fly   198 QAVQSICR-----VMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQLIQER 257
            .|:.|:.:     :...::.:.|....|:..|.:       :..::.:...:.|:....:|.:.|
  Rat   224 HALHSMFKSTTQLMFLPKNLTRWTSTQVWKGHFE-------SWDIISEYVTKCIKNVYRELAEGR 281

  Fly   258 NE-WKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSAIAFALS 321
            .: |.                    ::::|...:.||...|.......:....|||:.::...|.
  Rat   282 QQSWS--------------------VISEMVAQSTLSMDAIHANSMELIAGSVDTTAISLVMTLF 326

  Fly   322 LLSKNPDVQQRAFEEASELEG-------REKESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEVG 379
            .|::||||||...:|:...|.       :....:|.|.|.:|||||:||......|.|..||.:.
  Rat   327 ELARNPDVQQALRQESLAAEASIAANPQKAMSDLPLLRAALKETLRLYPIGSSLERIVDSDLVLQ 391

  Fly   380 KLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHPFAFAAFSAGPRNCIGQKFAML 444
            ...||.|..:...:|.:.|:|..||.|||:.|.|:|..::.   |...||..|.|.|:|::.|.:
  Rat   392 NYHVPAGTLVIIYLYSMGRNPAVFPRPERYMPQRWLERKRS---FQHLAFGFGVRQCLGRRLAEV 453

  Fly   445 ELKTSLAMLLR--------------SYRFL 460
            |:...|..:|:              :|||:
  Rat   454 EVLLLLHHMLKIFQVETLRQEDVQMAYRFV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 107/485 (22%)
Cyp11b3NP_861545.1 p450 41..494 CDD:278495 105/482 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.