DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and AgaP_AGAP002197

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_565621.4 Gene:AgaP_AGAP002197 / 3290579 VectorBaseID:AGAP002197 Length:368 Species:Anopheles gambiae


Alignment Length:430 Identity:118/430 - (27%)
Similarity:186/430 - (43%) Gaps:93/430 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GKDLMVMFTD-PEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGGESWHRRRKLLTPGFHFRI 135
            |..|:|...| ||..::::.:..||:|...|....  ...||||.....|...||||...|...:
Mosquito     2 GPKLIVAIKDNPEYFQKVMNSPHLLSKMDQYNFFR--AENGLLTAPEHVWKTERKLLNRSFSPMM 64

  Fly   136 LSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIKKHAQLQSDSEYVQAV 200
            ||.                                 |.||........                 
Mosquito    65 LSS---------------------------------FCLDTFLSLVFK----------------- 79

  Fly   201 QSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQLIQERNEWKPEAE 265
                ||:|.:.:     :...::.||......:.:        .:||.....|::|..|...:|:
Mosquito    80 ----RVLHVERY-----IECIYRLTKDYATESSCV--------NIIRNMSLDLMKEVKENAHQAQ 127

  Fly   266 QDDV----GAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKN 326
            |..|    |.|..|.|... |.:..:....|::..|::.:||.:..|||||::.||..|.:|:.:
Mosquito   128 QQPVEEAYGGKPALNFAHS-LSSLAKHNPSLTEDHIKDHIDTMIMAGHDTTATTIANLLLMLAMH 191

  Fly   327 PDVQQRAFEE--------ASELEGREKESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEV-GKLT 382
            |:||:..::|        :..:...:..::.|.|.|.|||:|::|..|...||...|::: .|.|
Mosquito   192 PEVQEMVYQEVMSVCPDKSKPVTMEDANNLAYTEMVCKETMRLFPVAPVIGRKCAADVKLDDKHT 256

  Fly   383 VPKGASISCLIYMLHRDPKNF-PDPERFDPDRFLVNE-KQMHPFAFAAFSAGPRNCIGQKFAMLE 445
            :|.|..::..||.:||||..: |:|.:|:||.||... .:.||:|:..||.|||||||.::|.|.
Mosquito   257 IPAGCCVALGIYQIHRDPMIWGPEPGKFNPDHFLPERVAERHPYAYLPFSGGPRNCIGIRYAWLS 321

  Fly   446 LKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRLRI 485
            :|..:|.|:|:|||     ..|..:.:||.|.  .|.|||
Mosquito   322 MKIMIAHLVRNYRF-----KTPLVMEDLVLKF--AIVLRI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 111/412 (27%)
AgaP_AGAP002197XP_565621.4 p450 <91..357 CDD:299894 90/280 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.