DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and cyp26b1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_997831.1 Gene:cyp26b1 / 324188 ZFINID:ZDB-GENE-030131-2908 Length:511 Species:Danio rerio


Alignment Length:539 Identity:130/539 - (24%)
Similarity:216/539 - (40%) Gaps:103/539 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTLA--LVAFVLWAAFLRYLPKILNFLRLQRFAKT------LPGP--TIGELIANVKKGEILNW 55
            ::|||  ||:..|..|..:.|.::       |:..|      ||.|  ::|..|.    ||..:|
Zfish    12 LATLAACLVSMALLLAVSQQLWQL-------RWTATRDKSCKLPMPKGSMGFPII----GETCHW 65

  Fly    56 L-------KELREKHGPVFRIWFGKDLMVMFTDPEDI-KQLLGNNQLLTKSRNYELLEPW----- 107
            .       ...|:|:|.||:.......::..|..|:: |.|:|.:.|:|..        |     
Zfish    66 FFQGAGFHASRRQKYGNVFKTHLLGRPLIRVTGAENVRKVLMGEHSLVTVD--------WPQSTS 122

  Fly   108 --LGKGLLTNG-GESWHRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRT-KANGESFDIYPY 168
              ||...|.|. |:...:|||:....|....|..:...:::   ::...||. .:|.:..::|..
Zfish   123 TLLGPNSLANSIGDIHRKRRKIFAKVFSHEALESYLPKIQQ---VIQETLRVWSSNPDPINVYRE 184

  Fly   169 ITLFALDAICETAMGIK-----KHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPG 228
            ....:.:......:|.:     .|....:..|:|:.|.|:             .:::.|...:.|
Zfish   185 SQRLSFNMAVRVLLGFRIPEEEMHCLFSTFQEFVENVFSL-------------PIDLPFSGYRKG 236

  Fly   229 -KEREAALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAEL 292
             :.|::..|.:            |:.|:|    ||...|    .|.....||:||.:..|...||
Zfish   237 IRARDSLQKSI------------EKAIRE----KPLHTQ----GKDYTDALDVLLESAKENNTEL 281

  Fly   293 SDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEE-------------ASELEGRE 344
            :..:::|.....:|....||:||....:..|.::|.|.::..||             ..||....
Zfish   282 TMQELKESTIELIFAAFATTASASTSLVMQLLRHPAVLEKLREELRSCGLLHDGCLCQGELRLDS 346

  Fly   345 KESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERF 409
            ..|:.||:.||||.||::..|....|...:..|:..:.||||.|:...|...|.....|.|.|.|
Zfish   347 IISLKYLDCVIKEVLRLFAPVSGGYRIATQTFELDGVQVPKGWSVMYSIRDTHDTSAVFKDVEAF 411

  Fly   410 DPDRFLV--NEKQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAE 472
            |||||..  :|.:...|.:..|..|.|:|:|::.|.|.||.....|....||.......|:.::.
Zfish   412 DPDRFSPERSEDREGRFHYLPFGGGVRSCLGKQLATLFLKLLAVELAGGSRFELSTRTFPRMISV 476

  Fly   473 LVTKSGNGIRLRILPRDEN 491
            .|....:|:|::....|.|
Zfish   477 PVVHPTDGLRVKFFGLDSN 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 115/473 (24%)
cyp26b1NP_997831.1 p450 1..489 CDD:299894 128/531 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.