DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:503 Identity:109/503 - (21%)
Similarity:213/503 - (42%) Gaps:69/503 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LIANVKKGEILNWLKELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEP- 106
            |..|:....||..:.:.|........:..|..:::...||..::.:|...:.|.|:    .|:. 
  Fly    48 LCINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDKT----FLQDG 108

  Fly   107 -WLGKGLLTNGGESWHRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKAN--GESFDIYPY 168
             ::.:|||...|:.|..|||.|.|.|...|::.|.:........:|.:.:|:.|  |::......
  Fly   109 FFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAA 173

  Fly   169 ITLFA---LDAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPG-- 228
            ..|.:   |:..|.|.||...:.....|:....:.:.:..:...:....|.::.:..:...|.  
  Fly   174 EDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELY 238

  Fly   229 KEREAALKVLHDETNRVIRLR-REQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAEL 292
            :|.:...|:|.|....::|.: |...:::....:...|....|.:||: |::.:.  |:....|:
  Fly   239 EESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRI-FIEQIF--QLAANGEM 300

  Fly   293 SDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKN----------------PDVQQRAFEEASELE 341
            :..:|.:|..:.:....:|.|::|..||..|:.|                |||.|...|:..:|.
  Fly   301 TLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLR 365

  Fly   342 GREKESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEVG----KLTVPKGASISCLIYMLHRDPKN 402
                    ||:|.:.|:||:..:||...|.|..|..:.    :..||:.:.:....:.:.||.:.
  Fly   366 --------YLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERW 422

  Fly   403 F-PDPERFDPDRFLVNEKQM--------------------HPFAFAAFSAGPRNCIGQKFAMLEL 446
            : .:..:|||.|||..|::.                    |.::|..||.|.|:|||:::.:..:
  Fly   423 WGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIM 487

  Fly   447 KTSLAMLLRSYRFLPDKDHQPKPLAELVT---KSGNGIRLRILPRDEN 491
            |..|..|:.::.|..|.:.:.....|.::   |:.:.|.|.|.|:.|:
  Fly   488 KVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQPKKES 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 102/476 (21%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 101/469 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.