DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp26c1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_217935.3 Gene:Cyp26c1 / 308190 RGDID:1308843 Length:518 Species:Rattus norvegicus


Alignment Length:500 Identity:130/500 - (26%)
Similarity:206/500 - (41%) Gaps:90/500 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLWAAFLRYLPKILNFLR--LQR-FAKTLPGP--TIGELIANVKKGEILNWL-------KELREK 62
            :|.|..|..|.:.|..||  |.| :|.|||.|  ::|....    ||.|:||       ...||:
  Rat    19 LLCAGLLLGLAQQLWTLRWTLSRDWASTLPLPKGSMGWPFF----GETLHWLVQGSRFHSSRRER 79

  Fly    63 HGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNG-GESWHRRRKL 126
            :|.||:.......::..:..|:::.:|.....|.:|:..:.....||...|... ||...:|||:
  Rat    80 YGTVFKTHLLGRPVIRVSGAENVRTILLGEHRLVRSQWPQSAHILLGSHTLLGAVGERHRQRRKV 144

  Fly   127 LTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAIC-ETAMGIKKHAQL 190
            |...|....|.:|...::|..|   |.:|:....:.    |.....|..|:. ..|..|....||
  Rat   145 LARVFSRPALEQFVPRLQEALR---REVRSWCAAQR----PVAVYQAAKALTFRMAARILLGLQL 202

  Fly   191 QSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQLIQ 255
             .::...:..|:..|:: :..||.  .|:|.|...:.|                 || .|:||.|
  Rat   203 -DEARCTELAQTFERLV-ENLFSL--PLDVPFSGLRKG-----------------IR-ARDQLYQ 245

  Fly   256 ERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSAIAFAL 320
            ..:|...|..::::.|:...| |.:::.:..|.|.|||..:::|.....:|....||:||....:
  Rat   246 HLDEVIAEKLREELTAEPGDA-LHLIINSARELGRELSVQELKELAVELLFAAFFTTASASTSLI 309

  Fly   321 SLLSKNPDVQQRAFEEASELEG---------REKESMP-----------------YLEAVIKETL 359
            .||.::|....:..:|.| .:|         |...|.|                 |::.|:||.|
  Rat   310 LLLLQHPAAIAKIQQELS-AQGLGSPCSCAPRASGSRPDCSCEPDLSLAVLGRLRYVDCVVKEVL 373

  Fly   360 RIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLH------RDPKNFPDPERFDPDRFLVNE 418
            |:.|.|....|..|...|:....:|||.|:...|...|      |.|     ||.|||:||.|..
  Rat   374 RLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDTHETAAVYRSP-----PEGFDPERFGVES 433

  Fly   419 KQMH----PFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRF 459
            :...    .|.:..|..|.|:|:||:.|...|:.....|:|:.|:
  Rat   434 EDARGSGGRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARW 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 119/471 (25%)
Cyp26c1XP_217935.3 p450 40..500 CDD:299894 122/478 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.