DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP4A22

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:511 Identity:183/511 - (35%)
Similarity:275/511 - (53%) Gaps:48/511 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STLALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGPTIGELIANVKKGEILNWLKELREK---- 62
            |.|.|:..::.||.| ||.:......||:|    |.|....|..::::.:....|:.::|:    
Human    23 SLLILLLLLIKAAQL-YLHRQWLLKALQQF----PCPPSHWLFGHIQEFQHDQELQRIQERVKTF 82

  Fly    63 -HGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSR-NYELLEPWLGKGLLTNGGESWHRRRK 125
             ....:.||.|| :.|...||:.:|.:||.:.  .||. :|:.|.|.:|.|||...|::|.:.|:
Human    83 PSACPYWIWGGK-VRVQLYDPDYMKVILGRSD--PKSHGSYKFLAPRIGYGLLLLNGQTWFQHRR 144

  Fly   126 LLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGES-FDIYPYITLFALDAICETAMGIKKHAQ 189
            :|||.||..||..:...|.::.|:::.:.......:| .:::.:::|..||.|.::|...:...|
Human   145 MLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKSAFSHQGSIQ 209

  Fly   190 LQSDSE-YVQAVQSICRVMHKQSFSFWQRLNVFFKH------TKPGKEREAALKVLHDETNRVIR 247
            :..:|: |:||:..:      .|..|....|.|.::      |..|:....|.::.|..|::||:
Human   210 VDRNSQSYIQAISDL------NSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTDQVIQ 268

  Fly   248 LRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTT 312
            ||:.||       :.|.|.:.:..||.|.|||:|||.:||.|:.|||.|:|.|||||||||||||
Human   269 LRKAQL-------QKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTT 326

  Fly   313 SSAIAFALSLLSKNPDVQQRAFEEASELEG-------REKESMPYLEAVIKETLRIYPSVPFFSR 370
            :|.|::.|..|:.:|..|:|..||...|.|       ...:.|||....|||.||:||.||...|
Human   327 ASGISWILYALATHPKHQERCREEIHGLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGR 391

  Fly   371 KVLEDLEV--GKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHPFAFAAFSAGP 433
            ::...:..  |: ::|||..:...||.||.:||.:|:.|.|||.||.....| |..||..||.|.
Human   392 ELSTPVTFPDGR-SLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAPGSAQ-HSHAFLPFSGGS 454

  Fly   434 RNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGI--RLRILP 487
            |||||::|||.:||.:.|:.|..:..|||....|.|:|.||.||.|||  |||.||
Human   455 RNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPMARLVLKSKNGIHLRLRRLP 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 158/456 (35%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 167/470 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154677
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3155
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.590

Return to query results.
Submit another query.