DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP4X1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:504 Identity:159/504 - (31%)
Similarity:254/504 - (50%) Gaps:41/504 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VAFVLWAAFLRYLPKILNFLRLQRFAKTL---PGPTIGELIANVK--KGEILNWLKELREKHGPV 66
            :|||...| |..|..|..:||.||..:.|   |.|.....:.:.|  :.:.:..|:|:.||:...
Human    16 LAFVFCLA-LGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRA 79

  Fly    67 FRIWFGK-DLMVMFTDPEDIKQLLG----NNQLLTKSRNYELLEPWLGKGLLTNGGESWHRRRKL 126
            |..|.|. .......||:..|.||.    .:|.|.|     ...|.|||||....|..|.:.|:|
Human    80 FPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQK-----FSPPLLGKGLAALDGPKWFQHRRL 139

  Fly   127 LTPGFHFRILSEFKEPMEENCRILVRRLR--TKANGESFDIYPYITLFALDAICETAMGIKKHAQ 189
            |||||||.||..:.|.|..:.::::.:..  ......|.::|.:|...:||.|.:.|...:.:.|
Human   140 LTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQ 204

  Fly   190 LQSDSE-YVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQL 253
            ..|..: |.:|:..:.:::..:.:|.....::.||.:..|...:...:||:..|:.:|:.|::.|
Human   205 TNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSL 269

  Fly   254 IQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSAIAF 318
                   :...:||:...::...|||::|..:.|.|:..||.|:..||.||:..||||.:::|::
Human   270 -------QAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISW 327

  Fly   319 ALSLLSKNPDVQQRAFEE-------ASELEGREKESMPYLEAVIKETLRIYPSVPFFSRKVLEDL 376
            .|..|:.||:.|:|..||       .|.:...:...|.|....||||.|:.|:||..||.:.:.|
Human   328 ILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPL 392

  Fly   377 EV-GKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRF-LVNEKQMHPFAFAAFSAGPRNCIGQ 439
            .. ...|:|.|.::...|:.||.:|..:.:|:.|||.|| ..|..|.||:|:..||||.||||||
Human   393 TFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQ 457

  Fly   440 KFAMLELKTSLAMLLRSYRFLPDKDHQPKPLA---ELVTKSGNGIRLRI 485
            :|||:|||.::|::|..:|..||   ..:||.   ..:.|..||:.|.:
Human   458 EFAMIELKVTIALILLHFRVTPD---PTRPLTFPNHFILKPKNGMYLHL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 142/455 (31%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 146/468 (31%)
heme binding region 447..460 10/12 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.