DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp24a1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_963966.1 Gene:Cyp24a1 / 25279 RGDID:2462 Length:514 Species:Rattus norvegicus


Alignment Length:507 Identity:125/507 - (24%)
Similarity:219/507 - (43%) Gaps:124/507 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RFAKTLPGPT----IGELIANVKKGEIL---NWLKELREKHGPVFRIWFGKDLMVMFTDPEDIKQ 87
            |...:|||||    :|.|:....||.:.   :.|.|..:|:|.:||:..|....|....|..::.
  Rat    53 RNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEA 117

  Fly    88 LLGNNQLLTKSRNYELLE--PWL--------GKGLLTNGGESWHR-----RRKLLTPGFHFR--- 134
            |     ..|:|.:.:.||  ||.        ..||:...|:.|.|     ::||:.|....:   
  Rat   118 L-----YRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDK 177

  Fly   135 ----ILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIKKHAQLQSDSE 195
                :|::|.|.|:|.|         ...|...|:|..:..::.::|| ..:..|:...||.::|
  Rat   178 KINEVLADFLERMDELC---------DERGRIPDLYSELNKWSFESIC-LVLYEKRFGLLQKETE 232

  Fly   196 -----YVQAVQSICRV----------MHKQ-SFSFWQ----RLNVFFKHTKPGKEREAALKVLHD 240
                 ::.|::::...          :||: :...||    ..:..||..||..:          
  Rat   233 EEALTFITAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCID---------- 287

  Fly   241 ETNRVIRLRREQLIQERNEWKPEA-------EQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIR 298
              ||:          :|...:|.|       :||.:..|...|.:..|.|..:|           
  Rat   288 --NRL----------QRYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVE----------- 329

  Fly   299 EEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASEL-------EGREKESMPYLEAVIK 356
                        ||::::.:.|..||:||..|:|..:|...:       ...:..:||||:|.:|
  Rat   330 ------------TTANSLMWILYNLSRNPQAQRRLLQEVQSVLPDNQTPRAEDLRNMPYLKACLK 382

  Fly   357 ETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQM 421
            |::|:.|||||.:|.:.:...:|:..:|||..::....:|.....||.|..:|.|:|:|..||::
  Rat   383 ESMRLTPSVPFTTRTLDKPTVLGEYALPKGTVLTLNTQVLGSSEDNFEDSHKFRPERWLQKEKKI 447

  Fly   422 HPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAEL 473
            :|||...|..|.|.|||::.|.|:|..:|..:::.|..:. .|::|..:..|
  Rat   448 NPFAHLPFGIGKRMCIGRRLAELQLHLALCWIIQKYDIVA-TDNEPVEMLHL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 123/496 (25%)
Cyp24a1NP_963966.1 CYP24A1 90..508 CDD:410738 113/470 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.