DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP19A1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens


Alignment Length:497 Identity:114/497 - (22%)
Similarity:197/497 - (39%) Gaps:137/497 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FLRLQRFAKT--LPGP----TIGELIAN-----VKKGEILNWLKELREKHGPVFRIWFGKDLMVM 78
            ||.:..:..|  :|||    .||.||::     :..|...|:...:   :|...|:|...:..::
Human    35 FLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRV---YGEFMRVWISGEETLI 96

  Fly    79 FTDPEDIKQLLGNNQLLTKSRNYELLEPWLG---KGLL-TNGGESWHRRR----KLLT-PGFHFR 134
            .:....:..::.:|...::..: :|....:|   ||:: .|..|.|...|    |.|: ||    
Human    97 ISKSSSMFHIMKHNHYSSRFGS-KLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPG---- 156

  Fly   135 ILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIKKH----AQLQSDSE 195
                           |||.:                     .:|  |..:|.|    .::.::|.
Human   157 ---------------LVRMV---------------------TVC--AESLKTHLDRLEEVTNESG 183

  Fly   196 YVQAVQSICRVMHKQS---------------------FSFWQRL----NVFF-------KHTKPG 228
            ||..:..:.|||...|                     |..||.|    ::||       |:.|..
Human   184 YVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSV 248

  Fly   229 KEREAALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELS 293
            |:.:.|::||..|..|  |:..|:.::|..::..|                 |:|.:..|  :|:
Human   249 KDLKDAIEVLIAEKRR--RISTEEKLEECMDFATE-----------------LILAEKRG--DLT 292

  Fly   294 DTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGR------EKESMPYLE 352
            ..::.:.:...:....||.|.::.|.|.|::|:|:|::...:|...:.|.      :.:.:..:|
Human   293 RENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVME 357

  Fly   353 AVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVN 417
            ..|.|::|..|.|....||.|||..:....|.||.:|...|..:|| .:.||.|..|..:.|..|
Human   358 NFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHR-LEFFPKPNEFTLENFAKN 421

  Fly   418 --EKQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSY 457
              .:...||.|     |||.|.|:..||:.:|..|..|||.:
Human   422 VPYRYFQPFGF-----GPRGCAGKYIAMVMMKAILVTLLRRF 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 111/485 (23%)
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 103/460 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154693
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.