DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP17A1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_000093.1 Gene:CYP17A1 / 1586 HGNCID:2593 Length:508 Species:Homo sapiens


Alignment Length:520 Identity:123/520 - (23%)
Similarity:208/520 - (40%) Gaps:107/520 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVAFVLWAAFLRYLPKILNFLRLQRFAKTLPG----------PTIGELIANVKKGEILNWLKELR 60
            |||.:|......:.||           :..||          |.:|.|....:.|.:.|...:|:
Human     4 LVALLLLTLAYLFWPK-----------RRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQ 57

  Fly    61 EKHGPVFRIWFGKDLMVMFTDPEDIKQLL--------GNNQLLT---KSRNYELLEPWLGKGL-L 113
            :|:||::.:..|....|:....:..|::|        |..|:.|   .|.|        .||: .
Human    58 KKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNN--------RKGIAF 114

  Fly   114 TNGGESW--HRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKA------NGESFDI-YPYI 169
            .:.|..|  |||..:.|    |.:..:..:.:|   :|:.:.:.|..      ||:|.|| :|..
Human   115 ADSGAHWQLHRRLAMAT----FALFKDGDQKLE---KIICQEISTLCDMLATHNGQSIDISFPVF 172

  Fly   170 TLF--ALDAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKERE 232
            ...  .:..||..........:|.....|.:.:  |..:...........|.:|     |.|..|
Human   173 VAVTNVISLICFNTSYKNGDPELNVIQNYNEGI--IDNLSKDSLVDLVPWLKIF-----PNKTLE 230

  Fly   233 ---AALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQM---EGGAE 291
               :.:|:.:|..|:::           ..:|.:...|.:     ...||.|:..:|   .|.|.
Human   231 KLKSHVKIRNDLLNKIL-----------ENYKEKFRSDSI-----TNMLDTLMQAKMNSDNGNAG 279

  Fly   292 -------LSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEG------- 342
                   |||..|...:......|.:||:|.:.:.|:.|..||.|:::.:||..:..|       
Human   280 PDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTI 344

  Fly   343 REKESMPYLEAVIKETLRIYPSVP-FFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDP 406
            .::..:..|||.|:|.||:.|..| ....|...|..:|:..|.||..:...::.||.:.|.:..|
Human   345 SDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQP 409

  Fly   407 ERFDPDRFL--VNEKQMHP-FAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRF-LPDKDHQP 467
            ::|.|:|||  ...:.:.| .::..|.||||:|||:..|..||...:|.||:.:.. :||....|
Human   410 DQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLP 474

  Fly   468  467
            Human   475  474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 117/491 (24%)
CYP17A1NP_000093.1 p450 28..493 CDD:306555 115/485 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.